You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494690 |
---|---|
Category | Proteins |
Description | Keratinocyte Growth Factor (KGF), also known as FGF-7 and HBGF-7, is a mitogen factor belonging to the heparin-binding growth factor family. It is expressed mainly by epithelial cells. KGF binds to fibroblast growth factor receptor 2b (FGFR2b) to form a dimeric complex and initiate downstream signals. KGF plays an important role in embryonic development, cell proliferation and differentiation. It has also been reported to function in kidney and lung development, angiogenesis, wound healing and tumor invasion. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 16-18 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIK GVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPM AIT |
Source | CHO |
Biological Activity | ED50 < 1 ng /ml, measured in a proliferation assay using 4MBr5 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human Keratinocyte Growth Factor(rhKGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Keratinocyte Growth Factor should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | FGF7, Keratinocyte Growth Factor, Fibroblast Growt Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating