You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494694 |
---|---|
Category | Proteins |
Description | Interleukin-7 (IL-7), also known as lymphopoietin 1 and pre-B cell factor, is a hematopoietic growth factor belonging to the IL-7/IL-9 family. It is produced by keratinocytes, dendritic cells, hepatocytes, neurons and epithelial cells. IL-7 binds and signals through IL-7 receptor,a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor.IL-7 plays a role in regulating early B cell and T cell development. It is also important for optimal dendritic cell-T cell interaction. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 8-28kDa, observed by reducing SDS-PAGE. |
Protein Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLN RAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH |
Source | CHO |
Biological Activity | ED50<0.4ng/ml, measured in a cell proliferation assay using 2E8 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant murine Interleukin-7 (IL-7), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-7 (IL-7), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-7, IL7 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
> 95% by SDS-PAGE. | |
KMP1757, Recombinant Mouse IL-7 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #P10168) fused with a 6×His Tag at the C-terminus. |
Filter by Rating