You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494696 |
---|---|
Category | Proteins |
Description | Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 54-56 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP |
Source | CHO |
Biological Activity | ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | IL-6RA, IL-6R1, CD126 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 39.4 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 64.7 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-hFc is approximately 70-100 kDa due to glycosylation. | |
Mammalian |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
> 95% by Tris-Bis PAGE, > 94% by SEC-HPLC | |
KMP2021, Recombinant Human IL-6R alpha Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu20-Pro365) of Human IL-6R alpha fused with a His Tag and Avi tag at the C-terminal. |
> 95% by Tris-Bis PAGE, > 94% by SEC-HPLC | |
KMP2020, Biotinylated Recombinant Human IL-6R alpha Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu20-Pro365) of Human IL-6R alpha fused with a His Tag and Avi tag at the C-terminal. |
Filter by Rating