You have no items in your shopping cart.
Cart summary
Recombinant IL-6R, Human
Catalog Number: orb1494696
| Catalog Number | orb1494696 |
|---|---|
| Category | Proteins |
| Description | Interleukin-6 Receptor Alpha, also known as IL-6RA, IL-6R1 and CD126, belongs to the type I cytokine receptor family. It is mainly expressed on T cells, fibroblasts and macrophages. IL-6RA couples with gp130 to form the IL-6 receptor; IL-6RA binds specifically to IL-6 and depends on gp130 to transmit signals. IL-6RA dysfunction has been correlated with the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Soluble IL-6RA, which consists of only the extracellular domain of IL-6RA, acts as an agonist of IL-6 activity. |
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| MW | 54-56 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRA GRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLA VPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRA ERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKD DDNILFRDSANATSLPVQDSSSVPLP |
| Source | CHO |
| Biological Activity | ED50 < 0.2 μg/ml, measured in a cell proliferation assay using M1 cells in the presence of 10 ng/ml human IL-6. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Storage | Lyophilized recombinant Human Interleukin-6 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Alternative names | IL-6RA, IL-6R1, CD126 Read more... |
| Note | For research use only |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Expiration Date | 6 months from date of receipt. |
Human IL6R Protein, His Tag [orb757423]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.4 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-His is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman IL6R Protein, hFc Tag [orb757474]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 64.7 kDa after removal of the signal peptide.The apparent molecular mass of IL6R-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman IL6R protein [orb391994]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human IL-6R alpha Protein, Avi His Tag [orb1550468]
> 95% by Tris-Bis PAGE, > 94% by SEC-HPLC
KMP2021, Recombinant Human IL-6R alpha Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu20-Pro365) of Human IL-6R alpha fused with a His Tag and Avi tag at the C-terminal.
500 μg, 100 μgBiotinylated Recombinant Human IL-6R alpha Protein, Avi His Tag [orb1550469]
> 95% by Tris-Bis PAGE, > 94% by SEC-HPLC
KMP2020, Biotinylated Recombinant Human IL-6R alpha Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Leu20-Pro365) of Human IL-6R alpha fused with a His Tag and Avi tag at the C-terminal.
500 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
