Cart summary

You have no items in your shopping cart.

    Recombinant IL-6, Human(CHO-expressed)

    Recombinant IL-6, Human(CHO-expressed)

    Catalog Number: orb1494697

    DispatchUsually dispatched within 5-10 working days
    $ 465.00
    Catalog Numberorb1494697
    CategoryProteins
    DescriptionInterleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.
    Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
    MW21-23 kDa, observed by reducing SDS-PAGE.
    Protein SequencePVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD MTTHLILRSFKEFLQSSLRALRQM
    SourceCHO
    Biological ActivityED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.
    Endotoxins< 0.2 EU/μg, determined by LAL method.
    StorageLyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
    Buffer/PreservativesLyophilized after extensive dialysis against PBS.
    Alternative namesInterleukin-6, IL6
    Read more...
    NoteFor research use only
    Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars