Recombinant IL-5, Rat (CHO-expressed)

• Catalog Number: orb1494699
• Category: Proteins
• Description: Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 13~21 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQ KEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
• Source: CHO
• Biological Activity: ED50 < 0.5 ng/ml, measured in a proliferation assay using TF-1 Cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-5, IL5
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.