You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494702 |
---|---|
Category | Proteins |
Description | Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 53-56 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE |
Source | CHO |
Biological Activity | ED50 < 0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Interleukin-5 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-5 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | IL-5RA, CD125 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating