Recombinant IL-4 R, Human

• Catalog Number: orb1494637
• Category: Proteins
• Description: Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 40-45 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL WAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
• Source: HEK 293
• Biological Activity: ED50 < 70 ng/ml, measured in a neutralization assay using TF-1 cells in the presence of 0.5ng/ml h-IL-4.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: IL-4R, IL-4RA, CD124
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.