You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494637 |
---|---|
Category | Proteins |
Description | Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 40-45 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL WAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Source | HEK 293 |
Biological Activity | ED50 < 70 ng/ml, measured in a neutralization assay using TF-1 cells in the presence of 0.5ng/ml h-IL-4. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | IL-4R, IL-4RA, CD124 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating