You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494703 |
---|---|
Category | Proteins |
Description | Interleukin-4 (IL-4) is a pleiotropic cytokine regulates diverse T and B cell responses including cell proliferation, survival, and gene expression. It has important effects on the growth and differentiation of different immunologically competent cells. Interleukin-4 is produced by mast cells, T cells, and bone marrow stromal cells [1]. IL-4 regulates the differentiation of native CD4+ T cells (Th0 cells) into helper Th2 cells, and regulates the immunoglobulin class switching to the IgG1 and IgE isotypes. IL-4 has numerous important biological functions including stimulating B-cells activation, T-cell proliferation and CD4+ T-cells differentiation to Th2 cells. It is a key regulator in hormone control and adaptive immunity [2]. IL-4 also plays a major role in inflammation response and wound repair via activation of macrophage into M2 cells [3]. IL-4 is stabilized by three disulphide bonds forming a compact globular protein structure [4]. Four alpha-helix bundle with left-handed twist is dominated half of the protein structure with 2 overhand connections and fall into a 2-stranded anti-parallel beta sheet [5]. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 15kDa, observed by reducing SDS-PAGE |
Protein Sequence | HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
Source | CHO |
Biological Activity | ED504 x 10ˆ6 units/mg |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant porcine Interleukin 4 (IL-4) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rpIL-4 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-4, IL4 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
26.2 kDa | |
Yeast |
Filter by Rating