Recombinant IL-4, His, Rat

• Catalog Number: orb1494706
• Category: Proteins
• Description: Interleukin-4 (IL-4), also known as BSF-1 and Lymphocyte stimulatory factor 1, is a secreted cytokine belonging to the IL-4/IL-13 family. It is produced by mast cells, T cells and bone marrow stromal cells. IL-4 signals through two receptor complexes: theIL4Rα/common γ chain and the IL4Rα-IL-13 Rα1 receptor complex. IL-4 regulates T cell and B cell proliferation, survival and gene expression. IL-4 also induces IgG and IgE class switching, and the upregulation of MHC-II production.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 18-22 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: HGCNDSPLREIINTLNQVTEKGTPCTEMFVPDVLTATRNTTENELICRASRVLRKFYFPRDVPPCLKNKSGVLGELRKLC RGVSGLNSLRSCTVNESTLTTLKDFLESLKSILRGKYLQSCTSMSHHHHHH
• Source: CHO
• Biological Activity: ED50 < 0.2 μg/ml, measured in a proliferationassay using C6 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant rat Interleukin-4 (IL-4), Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rat Interleukin-4 (IL-4), Hisshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-4, IL4
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.