Recombinant IL-3, Human(CHO-expressed)

• Catalog Number: orb1494707
• Category: Proteins
• Description: Interleukin-3 (IL-3) is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine.Recombinant human interleukin 3 expressed in CHO cells is glycosylated protein with molecular weight range from 17 to 30 kDa shown in non-reducing SDS-PAGE.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 17-30 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN LLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Source: CHO
• Biological Activity: ED50 1×10ˆ7 units/mg.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human Interlerkin 3 (IL-3) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-3, IL3
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.