You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494707 |
---|---|
Category | Proteins |
Description | Interleukin-3 (IL-3) is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine.Recombinant human interleukin 3 expressed in CHO cells is glycosylated protein with molecular weight range from 17 to 30 kDa shown in non-reducing SDS-PAGE. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 17-30 kDa, observed by non-reducing SDS-PAGE. |
Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN LLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Source | CHO |
Biological Activity | ED50 1×10ˆ7 units/mg. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human Interlerkin 3 (IL-3) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-3 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-3, IL3 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
~23 kDa, observed by reducing SDS-PAGE. | |
CHO |
18-19 kDa, observed by reducing SDS-PAGE. | |
CHO |
Filter by Rating