Recombinant IL-18 BP, Human

• Catalog Number: orb1494713
• Category: Proteins
• Description: Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 42-44 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHL PGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSP QQQG
• Source: CHO
• Biological Activity: ED50 < 30 ng /ml, measured in a bioassay using KG-1 cells in the presence of 50ng/ml Human IL-18.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Interleukin-18 Binding Protein; IL18 BP
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.