You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494716 |
---|---|
Category | Proteins |
Description | Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and mouse IL-13 is cross-species reactive.Recombinant human interleukin 13 expressed in CHO cells is glycosylated protein with molecular weight range from 25 to 45 kDa shown in non-reducing SDS-PAGE. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 25-45 kDa, observed by non-reducing SDS-PAGE. |
Protein Sequence | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQ FSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Source | CHO |
Biological Activity | ED50 6.7×10ˆ5 units/mg. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human Interleukin 13 (IL-13) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhIL-13 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-13, IL13 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating