You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494717 |
---|---|
Category | Proteins |
Description | Interleukin-13 (IL-13), also known as T-cell activation protein P600, is an immunoregulatory cytokine belonging to the IL-4/IL-13 family. It is produced by activated Th2 cells, mast cells and NK cells. IL-13 signals through a receptor complex composed of IL-4Rα and IL13Rα1 (or IL13Rα2). IL-13 inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α and IL-6 by monocytes and macrophages. It also induces B cell activation and IgE secretion. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 14-30 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTV SSLPDTKIEVAHFITKLLSYTKQLFRHGPFHHHHHH |
Source | CHO |
Biological Activity | ED50 < 20 ng /ml, measured in a cell proliferation assay using R&D TF-1 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant murine Interleukin-13 (IL-13), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-13 (IL-13), His should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-13, IL13 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating