Cart summary

You have no items in your shopping cart.

    Recombinant IL-12, Mouse

    Recombinant IL-12, Mouse

    Catalog Number: orb1494718

    DispatchUsually dispatched within 5-10 working days
    $ 780.00
    Catalog Numberorb1494718
    CategoryProteins
    DescriptionInterleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals throughtheIL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.
    Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
    MW27-29 kDa (p35) and 45-50 kDa (p40), observed by reducing SDS-PAGE.
    Protein Sequencep35: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTT RGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEA DPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEF LDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWL VQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEE TLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTP HSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS
    SourceCHO
    Biological ActivityED50 < 0.15 ng/ml, measured in a cell proliferation assay using 2D6 cells.
    Endotoxins< 0.2 EU/μg, determined by LAL method.
    StorageLyophilized recombinant murineInterleukin-12 (IL-12), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-12 (IL-12), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
    Buffer/PreservativesLyophilized after extensive dialysis against PBS.
    Alternative namesInterleukin-12, IL12
    Read more...
    NoteFor research use only
    Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
    Expiration Date6 months from date of receipt.
    • Mouse IL12A protein [orb707221]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Mouse IL12B protein [orb707222]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Mouse IL12RB2 protein [orb707223]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Mouse IL23A protein [orb707236]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Recombinant IL-12 p40 (Interleukin-12 p40), Mouse, AF [orb1178965]

      ELISA

      > 98% as determined by SDS-PAGE. Ni-NTA chromatography.

      Escherichia coli

      1 mg, 500 μg, 100 μg, 20 μg, 5 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars