You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494641 |
---|---|
Category | Proteins |
Description | Interleukin 12 (IL-12), also known as natural killer cell stimulatory factor (NKSF) or cytotoxic lymphocyte maturation factor (CLMF), is a pleiotropic cytokine originally identified in the medium of activated human B lymphoblastoid cell lines. The p40 subunit of IL-12 has been shown to have extensive amino acid sequence homology to the extracellular domain of the human IL-6 receptor while the p35 subunit shows distant but significant sequence similarity to IL-6, G-CSF, and chicken MGF. These observations have led to the suggestion that IL-12 might have evolved from a cytokine/soluble receptor complex. Human and mouse IL-12 share 70% and 60% amino acid sequence homology in their p40 and p35 subunits, respectively. IL-12 apparently shows species specificity with human IL-12 reportedly showing minimal activity in the mouse system. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | Approximately 75 kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit. |
Protein Sequence | p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTS TVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNML AVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS p40:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVK EFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSR GSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWS EWASVPCS |
Source | HEK 293 |
Biological Activity | EC50 1×10ˆ6 units/mg. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Interleukin 12(IL-12) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rh-IL12 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-12, IL12 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating