Cart summary

You have no items in your shopping cart.

    Recombinant IL-10, Mouse(CHO-expressed)

    Recombinant IL-10, Mouse(CHO-expressed)

    Catalog Number: orb1494722

    DispatchUsually dispatched within 5-10 working days
    $ 544.00
    Catalog Numberorb1494722
    CategoryProteins
    DescriptionInterleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.
    Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
    MW21-23 kDa, observed by reducing SDS-PAGE.
    Protein SequenceSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQA EKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
    SourceCHO
    Biological ActivityED50 < 0.2 ng/ml, measured in a cell proliferation assay using MC/9 cells.
    Endotoxins< 0.2 EU/μg, determined by LAL method.
    StorageLyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
    Buffer/PreservativesLyophilized after extensive dialysis against PBS.
    Alternative namesInterleukin-10, IL10
    Read more...
    NoteFor research use only
    Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
    Expiration Date6 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars