You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494640 |
---|---|
Category | Proteins |
Description | Interleukin-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 17~22 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
Source | HEK 293 |
Biological Activity | ED50 1 x 10ˆ8 units/mg |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat Interleukin 1β(IL-1β) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat IL-1β should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Interleukin-1β; IL-1β; Catabolin, Lymphocyte-activ Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating