Recombinant IGF-BP-2, His, Human

• Catalog Number: orb1494645
• Category: Proteins
• Description: IGF-BP-2,also known as Insulin-like growth factor-binding protein 2, IBP-2 and BP-2, is a cysteine-rich secreted protein belonging to the IGF-binding protein superfamily. It is expressed by the central nervous system, bone cells and reproductive tissues. IGF-BP-2 binds to both IGF-I and IGF-II, with a much higher binding affinity to IGF-II than IGF-I. IGF-BP-2 has been shown to inhibitand stimulate the growth promoting effects of IGFs, thus serving as a regulator for IGF distribution, function and activity.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 6-20 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: FRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSEL PLQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQH RQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQ RGECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQHHHHHH
• Source: HEK 293
• Biological Activity: ED50 < 2 μg/ml, measured in a bioassay using FDC-P1 cells in the presence of 15 ng/ml human IGF-II.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human IGF-BP-2, Hisremains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-2, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Insulin-like growth factor-binding protein 2, IBP-
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.