You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494726 |
---|---|
Category | Proteins |
Description | IFN-gamma Receptor II, also known as IFNGR2 and IFNGT1, is a transmembrane protein belonging to the type II cytokine receptor family. IFNGR2 is a non-ligand-binding beta chain of the IFN-gamma receptor. It is an integral part of the IFN-gamma signaling transduction pathway and is likely to interact with GAF, JAK1 and JAK2. Defects in IFNGR2 are a cause of autosomal recessive Mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 38-40 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | SQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPM DFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQ VKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQ |
Source | CHO |
Biological Activity | ED50 < 0.1 μg/ml, measured in a cell cytotoxicity assay using HT-29 (HTB-38) cells in the presence of 1ng/ml human IFN-gamma. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human IFN-gamma Receptor II remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human IFN-gamma Receptor II should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | IFNGR2, IFNGT1 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating