You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494646 |
---|---|
Category | Proteins |
Description | Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | ~23 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL TGYLRN |
Source | HEK 293 |
Biological Activity | ED50 < 0.1 ng/ml, measured in a proliferation assay using TF-1 Cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Leukocyte interferon, B cell interferon, Type I in Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 90% by SDS-PAGE gel analyses | |
40.7 kDa | |
E.Coli |
Filter by Rating