Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

• Catalog Number: orb2657906
• Category: Proteins
• Description: Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 20 kDa
• UniProt ID: P15692
• Protein Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Protein Length: Full Length of Mature Protein of Isoform VEGF165
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured in a cell proliferation assay using HUVEC human umbilic vein endothelial cells. The ED50 for this effect is 0.2-10 ng/mL.
• Expression Region: 27-191aa
• Endotoxins: ≤10 EU/mg by the LAL method
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
• Alternative names: Vascular Endothelial Growth Factor Isoform 165; VE
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.