You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2280209 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15) (Active) |
Tag | N-terminal 10xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 24.6 kDa |
UniProt ID | O95150 |
Protein Sequence | MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Protein Length | Full Length of Isoform 2 |
Source | Mammalian cell |
Expression System | 1-192aa |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody. The EC50 is 0.8389-0.9731 ng/mL. |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Buffer/Preservatives | Lyophilized powder |
Alternative names | TL1, VEGI Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE. | |
25.4 kDa | |
Mammalian cell |
Filter by Rating