Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

• Catalog Number: orb2280208
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)
• Tag: N-terminal 10xHis-Avi-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 25.4 kDa
• UniProt ID: O95150
• Protein Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Protein Length: Partial of Isoform 1
• Source: Mammalian cell
• Expression System: 72-251aa
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.2732 - 0.6370 ng/mL.
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized powder
• Alternative names: TL1, VEGI
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.