You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1095874 |
---|---|
Category | Proteins |
Description | Recombinant Human papillomavirus type 16 Protein E7(E7) (Active) |
Tag | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 16.3 kDa |
UniProt ID | P03129 |
Protein Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
Protein Length | Full Length |
Source | E.coli |
Biological Origin | Human papillomavirus type 16 |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL |
Expression Region | 1-98aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Alternative names | Protein E7 Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating