You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1096691 |
---|---|
Category | Proteins |
Description | Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active) |
Tag | C-terminal 6xHis-mFC-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 55.3kDa |
UniProt ID | P0DTC2 |
Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 μg/ml can bind human ACE2 (CSB-MP866317HU-B), the EC50 is 2.492-4.401 ng/ml. |
Expression Region | 319-541aa(N501Y) |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
Alternative names | / Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
27.9 kDa | |
Mammalian cell |
Filter by Rating