Recombinant Human NOGGIN (rHuNOGGIN )

• Catalog Number: orb1494945
• Category: Proteins
• Description: Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.
• Form/Appearance: Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• MW: Approximately 46.2 kDa non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
• Protein Sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCG WIPIQYPIIS ECKCSC
• Source: Escherichia coli.
• Biological Activity: The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 µg/ml of NOGGIN, corresponding to a Specific Activity of ＞1.25 x 104 IU/mg.
• Endotoxins: Less than 1EU/g of rHu NOGGIN as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.