Recombinant Human MCP-4 (rHuMCP-4/CCL13 )

• Catalog Number: orb1494953
• Category: Proteins
• Description: CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
• Form/Appearance: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
• Purity: > 96% by SDS-PAGE and HPLC analyses.
• MW: 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
• Protein Sequence: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
• Source: Escherichia coli.
• Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg.
• Endotoxins: Less than 1EU/mg of rHuMCP-4/CCL13 as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.