Recombinant Human Interleukin-6 (IL6) (Active)

• Catalog Number: orb2657920
• Category: Proteins
• Description: Recombinant Human Interleukin-6 (IL6) (Active)
• Tag: Tag free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 20.8 kDa
• UniProt ID: P05231
• Protein Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Protein Length: Full Length of Mature Protein
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured in a cell proliferation assay using M-NSF-60 cells. The ED50 for this effect is 0.2-1 ng/mL.
• Expression Region: 30-212aa
• Endotoxins: ≤10 EU/mg by the LAL method
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
• Alternative names: Interleukin-6; IL-6; B-Cell Stimulatory Factor 2;
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.