You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1881858 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-6(IL6) (Active) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 22.8 kDa |
UniProt ID | P05231 |
Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IL6 at 2 μg/mL can bind Anti-IL6 recombinant antibody . The EC50 is 35.80-41.82 ng/mL. |
Expression Region | 30-212aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0 |
Alternative names | IFNB2 Read more... |
Background | Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 95% as determined by SDS-PAGE. | |
20.9 kDa | |
E.coli |
20.9 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |
Filter by Rating