You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1179075 |
---|---|
Category | Proteins |
Description | Recombinant Human IL-12 (p70), His Tag, HEK293, Human,AF |
Tested applications | ELISA |
Reactivity | Human |
Tag | His-tag |
Form/Appearance | Lyophilized |
Purity | > 98% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Entrez | 40, 35, 3593, 3592 |
Protein Sequence | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGSTSGSGKPGSGEGSTKGRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH. |
Source | HEK293 |
Biological Activity | Measure by its ability to induce IFN gamma secretion in PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is 0.05-0.2 ng/mL. |
Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating