Recombinant Human Glia Maturation Factor beta (rHuGMF-β)

• Catalog Number: orb1495055
• Category: Proteins
• Description: GMF-β, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-β appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.
• Form/Appearance: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
• Purity: > 98% by SDS-PAGE and HPLC analyses.
• MW: Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
• Protein Sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH
• Source: Escherichia coli.
• Biological Activity: Data Not Available.
• Endotoxins: Less than 1EU/g of rHuGMF-b as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.