Recombinant Human Eotaxin-2 (rHuEotaxin-2/CCL24)

• Catalog Number: orb1494982
• Category: Proteins
• Description: Eotaxin, also named MPIF-2 and Ckβ6, is a novel CC chemokine recently identified. It is produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Additionally, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues (92 a.a. residues for the murine homolog, without C-terminal truncation).
• Form/Appearance: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Purity: > 97% by SDS-PAGE and HPLC analyses.
• MW: 8.8 kDa, a single non-glycosylated polypeptide chain containing 78 amino acids.
• Protein Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVA
• Source: Escherichia coli.
• Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood eosinophils using a concentration range of 50.0 -100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg.
• Endotoxins: Less than 1EU/mg of rHuEotaxin-2/CCL24 as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.