Recombinant Human ENA-78(5-78a.a.) ( rHuENA-78(CXCL5))

• Catalog Number: orb1494985
• Category: Proteins
• Description: Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.
• Form/Appearance: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
• Purity: > 97% by SDS-PAGE and HPLC analyses.
• MW: 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
• Protein Sequence: AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
• Source: Escherichia coli.
• Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/ml, corresponding to a Specific Activity of ＞1 x 105 IU/mg.
• Endotoxins: Less than 1EU/mg of rHuENA-78/CXCL5 as determined by LAL method.
• Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
• Buffer/Preservatives: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Expiration Date: 6 months from date of receipt.