Recombinant Human Claudin-6(CLDN6)-VLPs, Fluorescent (Active)

• Catalog Number: orb1785364
• Category: Proteins
• Description: Recombinant Human Claudin-6(CLDN6)-VLPs, Fluorescent (Active)
• Tag: C-terminal GFP-tagged(This tag can be tested only under denaturing conditions)
• Form/Appearance: Lyophilized powder
• Purity: Testing in progress.
• MW: 50.5 kDa
• UniProt ID: P56747
• Protein Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
• Protein Length: Full Length
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 0.5574-0.7361 ng/mL.
• Expression Region: 1-220aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: UNQ757;PRO1488
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
• Expiration Date: 6 months from date of receipt.