You have no items in your shopping cart.
Cart summary
Recombinant Human C-C motif chemokine 5 (CCL5)
Catalog Number: orb1096597
| Catalog Number | orb1096597 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human C-C motif chemokine 5(CCL5) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.9 kDa |
| UniProt ID | P13501 |
| Protein Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 24-91aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | EoCPEosinophil chemotactic cytokine, SIS-delta, Sm Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human CCL5 protein (Active) [orb359071]
> 98% as determined by SDS-PAGE and HPLC.
7.8 kDa
E.Coli
5 μg, 100 μg, 500 μg Human CCL5 Protein [orb1471710]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
7.8 KDa
E. Coli
10 μg, 50 μgHuman CCL5 protein [orb705234]
Greater than 90% as determined by SDS-PAGE.
11.9 kDa
E.coli
100 μg, 20 μg, 1 mgRecombinant Human CCL5/RANTES Protein, No Tag [orb1552729]
≥90% as determined by SDS-PAGE
This protein contains the human CCL5(Ser24-Ser91) was fused without Tag and expressed in E. coli.
100 μg, 50 μgRecombinant Human CCL5/RANTES Protein, Fc & His Tag [orb1552730]
≥90% as determined by SDS-PAGE
This protein contains the human CCL5(Ser24-Ser91) was fused with the C-terminal Fc and His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
