You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1495068 |
---|---|
Category | Proteins |
Description | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Form/Appearance | Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4. |
Purity | > 97% by SDS-PAGE and HPLC analyses. |
MW | 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids. |
Protein Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Source | Escherichia coli. |
Biological Activity | Data Not Available. |
Endotoxins | Less than 1EU/g of rHuCNTF as determined by LAL method. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | Lyophilized from a 0.2m filtered concentrated solution in PBS, pH 7.4. |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Expiration Date | 6 months from date of receipt. |