Cart summary

You have no items in your shopping cart.

    Recombinant HGF, Human

    Recombinant HGF, Human

    Catalog Number: orb1494728

    DispatchUsually dispatched within 5-10 working days
    $ 544.00
    Catalog Numberorb1494728
    CategoryProteins
    DescriptionHepatocyte Growth Factor (HGF),also known as hepatopoietin-A and scatter factor, is a pleiotropic mitogen belonging to the peptidase S1 family (plasminogen subfamily). It is produced by mesenchymal cells and acts on epithelial cells, endothelial cells and haemopoietic progenitor cells. HGF binds to the proto-oncogenic c-Met receptor to activate a tyrosine kinase signaling cascade. It regulates cell growth, motility and morphogenesis, thus it plays a pivotal role in angiogenesis, tumorogenesis and tissue regeneration.Recombinant human Hepatocyte Growth Factor (rhHGF) is produced in CHO cells and consists of two polypeptide chains (α-chain and β-chain) held by a single disulfide bond resulting in the formation of a biologically active heterodimer. The α-chain consists of 463 amino acid residues and four kringle domains. The β-chain consists of 234 amino acid residues. A fully biologically active molecule, rhHGF has a molecular mass of around 88-90 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
    Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
    MW88-90 kDa (single chain), 59-61kDa (alpha chain), 30-34kDa (beta chain), observed by reducing SDS-PAGE.
    Protein SequenceQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKE FGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFT SNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWC YTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRE NYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPD ASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSL RYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLD DFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEG DYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
    SourceCHO
    Biological ActivityED50 1×10ˆ5 units/mg.
    Endotoxins< 0.2 EU/μg, determined by LAL method.
    StorageLyophilized recombinant humanHepatocyte Growth Factor (HGF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Hepatocyte Growth Factor (HGF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
    Buffer/PreservativesLyophilized after extensive dialysis against PBS.
    Alternative namesHepatocyte Growth Factor
    Read more...
    NoteFor research use only
    Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
    Expiration Date6 months from date of receipt.
    • Human IL6 protein (Active) [orb358972]

      > 96% as determined by SDS-PAGE and HPLC.

      20.7 kDa

      E.Coli

      5 μg, 100 μg, 500 μg
    • Human HGF Protein, hFc Tag [orb1173715]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 105.8 kDa after removal of the signal peptide.The apparent molecular mass of HGF-hFc is approximately 100-130 kDa due to glycosylation.

      Mammalian

      100 μg, 10 μg, 50 μg
    • Human MET protein [orb706908]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Human MET protein [orb706909]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Human MET protein [orb706910]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars