You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494730 |
---|---|
Category | Proteins |
Description | Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 12-14 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGER CHGLSL |
Source | CHO |
Biological Activity | ED50 < 0.5 ng/ml, measured in a cell proliferation assay using 3T3 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | DTR, DTS, HEGFL Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
9.7 kDa | |
E.Coli |
HPLC, SDS-PAGE | |
Unconjugated | |
> 96% by SDS-PAGE and HPLC analyses | |
9.0 kDa |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
15.1 KDa | |
Mammalian |
> 95% as determined by SDS-PAGE | |
10.1 kDa | |
E. coli |
> 95% as determined by SDS-PAGE | |
10.1 kDa | |
E. coli |
Filter by Rating