Recombinant GRO/MGSA/CXCL1, Human

• Catalog Number: orb1494733
• Category: Proteins
• Description: GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: ~7.8 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Source: CHO
• Biological Activity: Active, measured in a functional assay using HUVEC cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human GRO/MGSA/CXCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO/MGSA/CXCL1 should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Growth Regulated Protein/Melanoma Growth Stimulato
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.