You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494735 |
---|---|
Category | Proteins |
Description | Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 16-26 kDa, observed by non-reducing SDS-PAGE. |
Protein Sequence | APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK |
Source | CHO |
Biological Activity | ED50 2×10ˆ8 units/mg. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Granulocyte Macrophage Colony Stimulating Factor, Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
FA, HPLC, SDS-PAGE | |
Unconjugated | |
> 95.0% as determined by(a)Analysis by RP-HPLC.(b)Analysis by SDS-PAGE. |
> 97% by SDS-PAGE. | |
KMP1331, Recombinant Rat GM-CSF/CSF2 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Ala18-Lys144) of rat GM-CSF/CSF2 (Accession #NP_446304.1.) fused with a 6×His Tag at the N-terminus. |
16.3 kDa, observed by non-reducing SDS-PAGE. | |
Escherichia coli. |
Filter by Rating