Recombinant GM-CSF, Mouse

• Catalog Number: orb1494736
• Category: Proteins
• Description: Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 15~19 kDa, observed by non-reducing SDS-PAGE.
• Protein Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Source: CHO
• Biological Activity: ED50 2 x 10ˆ7 units/mg.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Granulocyte Macrophage Colony Stimulating Factor,
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.