You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494743 |
---|---|
Category | Proteins |
Description | Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP2 is most closely related to ENA78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence). The structure and sequence of the genes for human GCP2 and ENA78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 9 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN |
Source | CHO |
Biological Activity | The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human GCP-2°CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2°CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | CXCL6, GCP-2 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
Filter by Rating