Recombinant G-CSF, Rat (HEK 293-expressed)

• Catalog Number: orb1494648
• Category: Proteins
• Description: Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 25~28 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKC LSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVT SYLQSFLETAHHALHHLPRPAQKHFPESLFISI
• Source: HEK 293
• Biological Activity: ED50 < 5 pg/ml, measured in a cell proliferation assay using NFS-60 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Granulocyte Colony-Stimulating Factor, CSF-3, CSF3
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.