Recombinant G-CSF, Mouse

• Catalog Number: orb1494741
• Category: Proteins
• Description: Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 22-24 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAI SYLQGFLETARLALHHLA
• Source: CHO
• Biological Activity: ED50 < 0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Granulocyte Colony-Stimulating Factor, CSF-3, CSF3
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.