You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494745 |
---|---|
Category | Proteins |
Description | Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4]. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE. |
Protein Sequence | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
Source | CHO |
Biological Activity | ED50 1 x 10ˆ6 units/mg |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | Flt3 ligand, FL, Flt3LG, SL cytokine, Fms-related Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
16.9 kDa | |
E.Coli |
> 95% as determined by SDS-PAGE | |
24-30 kDa |
Filter by Rating