Recombinant FGF-21, His, Human

• Catalog Number: orb1494748
• Category: Proteins
• Description: FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 23-25kDa, observed by reducing SDS-PAGE.
• Protein Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPSQGRSPSYASHHHHHH
• Source: CHO
• Biological Activity: ED50<0.3μg/ml, measured in a bioassay using NIH-3T3 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: FGF21, fibroblast growth factor-21, FGFL
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.