You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494748 |
---|---|
Category | Proteins |
Description | FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 23-25kDa, observed by reducing SDS-PAGE. |
Protein Sequence | HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG ALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDV GSSDPLSMVGPSQGRSPSYASHHHHHH |
Source | CHO |
Biological Activity | ED50<0.3μg/ml, measured in a bioassay using NIH-3T3 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | FGF21, fibroblast growth factor-21, FGFL Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
≥90% as determined by SDS-PAGE | |
This protein contains the human FGF21(His29-Ser209) was fused with the N-terminal His Tag and expressed in E. coli. |
Filter by Rating