Recombinant Fas R, Human

• Catalog Number: orb1494650
• Category: Proteins
• Description: Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 17~29 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS
• Source: HEK 293
• Biological Activity: ED50 < 0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: soluble Fas receptor (sFasR), TNFRSF6, CD95, Apo I
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.