You have no items in your shopping cart.
Cart summary
Recombinant DKK-1, Mouse
Catalog Number: orb1494754
| Catalog Number | orb1494754 |
|---|---|
| Category | Proteins |
| Description | Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbate in vitro. DKK-1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK-1 not only functions in head formation during development, but also regulates joint remodeling and bone formation indicating its potential role in the pathogenesis of rheumatoid arthritis and multiple myeloma.Recombinant Mouse Dickkopf-related protein 1 produced in CHO cells is a polypeptide chain containing 243 amino acids. A fully biologically active molecule, rmDKK-1 has a molecular mass of 19~20 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript. |
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| MW | 19-20 kDa, observed by reducing SDS-PAGE. |
| Protein Sequence | SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEE CGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPR GEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHF WSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQR H |
| Source | CHO |
| Biological Activity | ED50 < 6 µg/ml, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| Storage | Lyophilized recombinant Mouse Dickkopf-related protein 1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Mouse Dickkopf-related protein 1 should be stable up to 1 week at 4°C or up to 3 months at -20°C. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Alternative names | DKK1 Read more... |
| Note | For research use only |
| Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
| Expiration Date | 6 months from date of receipt. |
Human DKK1 Protein, mFc Tag [orb1743312]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 52.0 kDa after removal of the signal peptide. The apparent molecular mass of DKK1-mFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Mouse Dkk-1 Protein, His Tag [orb1550796]
> 87% by SDS-PAGE.
KMP1693, Recombinant Mouse Dkk-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-His Tag272) of mouse Dkk-1 (Accession #NP_034181.2. ) fused with a 6×His Tag at the C-terminus.
100 μg, 50 μgRecombinant Mouse Dkk-1 Protein, 8*His Tag [orb1552542]
≥90% as determined by SDS-PAGE
This protein contains the mouse Dkk1(Thr32-His272) was fused with the N-terminal 8- His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Mouse Dickkopf-Related Protein 1/mDKK1/DKK-1 (N-8His) [orb1649077]
10 μg, 50 μg, 500 μg, 1 mgMouse DKK1 protein [orb753577]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
29.8 kDa
E.Coli
100 μg, 1 mg, 200 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
