You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494756 |
---|---|
Category | Proteins |
Description | Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues. |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
MW | 24~26kDa, observed by reducing SDS-PAGE. |
Protein Sequence | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Source | CHO |
Biological Activity | ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells. |
Endotoxins | < 0.2 EU/μg, determined by LAL method. |
Storage | Lyophilized recombinant Human Cardiotrophin-1°CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1°CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
Alternative names | CT1 Read more... |
Note | For research use only |
Application notes | Reconstituted in ddH2O or PBS at 100 μg/ml. |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human CTF1(Met1-Ala201) was fused with the N-terminal His Tag and expressed in E. coli. |
> 95% as determined by SDS-PAGE | |
21 kDa | |
E. coli |
> 95% as determined by SDS-PAGE | |
21 kDa | |
E. coli |
> 95% as determined by SDS-PAGE | |
21 kDa | |
E. coli |
Filter by Rating