Recombinant Adiponectin, Human(CHO-expressed)

• Catalog Number: orb1494761
• Category: Proteins
• Description: Adiponectin is an important adipokine involved in the control of fat metabolism and insulin sensitivity. It is synthesized exclusively by adipocytes and secreted into plasma. It antagonizes THF-alpha by negatively regulating its expression. It also inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin can form low molecular weight complexes (LMW), middle molecular weight complexes (MMW) and higher molecular weight complexes (HMW). These bind to various growth factors, such as HBEGF, PDGFB and FGF2, and play a role in cell growth, angiogenesis and tissue remodeling.
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• MW: 25~28 kDa, observed by reducing SDS-PAGE.
• Protein Sequence: ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQ GRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKK DKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
• Source: CHO
• Biological Activity: ED50 < 2ng/ml, measured in a cell growth inhibition assay using M1 cells.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Storage: Lyophilized recombinant Human Adiponectin remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Adiponectinshould be stable up to 1 week at 4°C or up to 2 months at -20°C.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Alternative names: Acrp-30, Acrp-30, GBP-28, GBP28, Apm-1
• Note: For research use only
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Expiration Date: 6 months from date of receipt.